PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G269100.1.p
Common NamePRUPE_ppa009776mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Whirly
Protein Properties Length: 279aa    MW: 30543.7 Da    PI: 10.1527
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G269100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly216.82e-671012391139
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                         s+yk+kaal+v++++p+f+aldsg++kl+r+G++ll++a+a+++r ydW++kq+f+ls+te+++lv l+skes effhdp++++s+eGkvr
  Prupe.1G269100.1.p 101 SIYKGKAALTVEPKAPEFTALDSGAFKLSREGFVLLQFAPAAGVRVYDWSRKQVFSLSVTEIGSLVCLGSKESIEFFHDPFKGKSDEGKVR 191
                         7****************************************************************************************** PP

              Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                         k+lkvePlpdGsG+f+nlsv+n+l++ +es+++P+++aefavl+s+++
  Prupe.1G269100.1.p 192 KVLKVEPLPDGSGHFFNLSVQNKLINLDESVYIPITRAEFAVLKSAFN 239
                         *********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.3E-7693262IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-7794278IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.4E-59102237IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MLRLHSLSSP AVAAQNPNQN PKQCLASELS SRARVFSTNS FGFAPSLSSS RKRLSLKCRQ  60
SEYFDQQRAS TASAPNKPSP PAPQTPAGGT GLPPRFFVGH SIYKGKAALT VEPKAPEFTA  120
LDSGAFKLSR EGFVLLQFAP AAGVRVYDWS RKQVFSLSVT EIGSLVCLGS KESIEFFHDP  180
FKGKSDEGKV RKVLKVEPLP DGSGHFFNLS VQNKLINLDE SVYIPITRAE FAVLKSAFNF  240
ILPYILGWHA YANSIKPEDS SRMNNSSSRY GGDFEWSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1079427736219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1079427736219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1079427736219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1079427736219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007222475.10.0hypothetical protein PRUPE_ppa009776mg
SwissprotQ9M9S31e-126WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLM5XCL90.0M5XCL9_PRUPE; Uncharacterized protein
STRINGVIT_01s0026g01720.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-118ssDNA-binding transcriptional regulator